PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013627020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 243aa    MW: 27739.8 Da    PI: 8.953
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013627020.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.42.6e-161057148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd ll +++ ++G g W+ ++ + g++R++k+c++rw++yl
   XP_013627020.1 10 KGAWTAEEDSLLRRCIDKYGEGKWHQVPLRAGLNRCRKSCRLRWLNYL 57
                     79********************************************97 PP

2Myb_DNA-binding23.61.2e-0763101148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + +E +ll++++k+lG++        ++ gRt++++k++w+++l
   XP_013627020.1  63 RGKLSSDEVDLLLRLHKLLGNR--------LP-GRTANDIKNYWNTHL 101
                      788999**************99........**.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.508561IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-21560IPR009057Homeodomain-like
SuperFamilySSF466892.12E-22897IPR009057Homeodomain-like
SMARTSM007172.7E-14959IPR001005SANT/Myb domain
PfamPF002492.4E-151057IPR001005SANT/Myb domain
CDDcd001671.83E-101257No hitNo description
Gene3DG3DSA:1.10.10.601.0E-1261104IPR009057Homeodomain-like
SMARTSM007174.3E-562103IPR001005SANT/Myb domain
PROSITE profilePS5129412.77862105IPR017930Myb domain
PfamPF002495.8E-663101IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009745Biological Processsucrose mediated signaling
GO:0009753Biological Processresponse to jasmonic acid
GO:0019430Biological Processremoval of superoxide radicals
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0050832Biological Processdefense response to fungus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MEDSSKGLTK GAWTAEEDSL LRRCIDKYGE GKWHQVPLRA GLNRCRKSCR LRWLNYLKPT  60
IKRGKLSSDE VDLLLRLHKL LGNRLPGRTA NDIKNYWNTH LSKKHEPCCK TKMKKRNVTF  120
SSTTPAQKID VFKPRPRLFT VNNGCSHLHG LPEVDVVPPC LGLNNINNVC ENSMTYCNKA  180
GEKYELFSNL MDGENMWWES LLEESKQPDG LVPKGTATKK GATFAFDVEQ LWNMLDGETV  240
ELD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-1781042104MYB PROTO-ONCOGENE PROTEIN
1mse_C3e-1781042104C-Myb DNA-Binding Domain
1msf_C3e-1781042104C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bol.141607e-43leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7382840.0KF738284.1 Brassica napus MYB transcription factor 90 (MYB90.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013627020.10.0PREDICTED: transcription factor MYB114 isoform X2
SwissprotQ9FE251e-123MYB75_ARATH; Transcription factor MYB75
TrEMBLA0A0A7DNN80.0A0A0A7DNN8_BRANA; MYB transcription factor 90
STRINGBra001917.1-P1e-166(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56650.11e-121production of anthocyanin pigment 1